Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
11 Cyber Services LLCReport or remove this logo

11 Cyber Services LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary MSHAEDK4XNN3· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 88XL3· MOUNT PLEASANT, SC· Active registration until Aug 30, 2027· 11cyber.com (opens in a new tab)

Overview

Buyers and offices that award 11 Cyber Services prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyMissile Defense Agency$500Navy$500MISSILE DEFENSE AGENCY (MDA)(HQ0859)$500 · Missile Defense Agency officeNSWC DAHLGREN (N00178)$500 · Navy office11 Cyber Services LLC$1,000
Awards toSubcontracts toCircle area = dollars

Insight MISSILE DEFENSE AGENCY (MDA) (HQ0859) is its largest buyer. See more on the Buyers tab

2 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2025–FY2026

$1,000

Includes FY2026 so far: $500, still being reported

Subcontracts it received

$15.8M

from 2 primes

About

From the company's SBA profile, updated Aug 2026

11 Cyber Services, LLC, (11CS) is a minority-owned small business based in Charleston, SC, since 2019. We specialize in securing systems and delivering mission assurance for the federal and commercial clients through a risk-based approach. We have 20+ years of experience in cyber security supporting various DoD and other federal organizations. Currently, we support Naval Sea Systems Command (NAVSEA) and Naval Information Warfare Center (NIWC) as a subcontractor. We provide cybersecurity engineering, risk management, cross domain solutions integration, and project management services. We were awarded Seapor-NxG IDIQ in 2024 and MDA SHIELD in 2025. We maintain a TS Facility Clearance. 11CS is focused on four main areas of cybersecurity and IT - engineering, evaluations/assessments, cross domain, and risk management framework (RMF). Proper credentials and certifications are held to comply with DoD and Industry requirements.

Prime contract obligations by fiscal year, US$, FY2025–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY25$500FY26$500 so far

Insight Largest year: $500 in FY2025. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Alabama$500 · 50%
  2. South Carolina$500 · 50%
Circle area = dollarsOutlined: head office state (South Carolina)

Insight 50% was performed in Alabama. See more on the Contracts tab