Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

1aardvark, LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary UNQGFCDMTU29· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 9HB53· MANASSAS, VA· Active registration until Jul 30, 2027· 1aardvark.co (opens in a new tab)

Overview

Buyers, 1aardvark and its subcontractors, US$, contracts active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026; subcontractors: reported value since award

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companySubcontractorsMissile Defense Agency$1.93MAir Force$804KDefense Logistics Agency$413KMISSILE DEFENSEAGENCY (MDA) (HQ0860)$1.93M · Missile Defense…FA2401 SPACEDEVELOPMENT AGENCYSDA$804K · Air Force officeDLA TROOP SUPPORT(SPE8EN)$413K · Defense Logistic…2 more offices$5001aardvark, LLC$3.15MAstronetix LLC$100KSimiantek LLC$100K
Awards toSubcontracts toCircle area = dollars

Insight Two subcontractorsSubcontractor (sub): a company hired by the prime to do part of a federal contract. It works for the prime, not the government. Glossary received 100% of what it reported subcontracting. See more on the Teaming tab

5 buying officesAll 2 subcontractors

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2023–FY2026

$3.15M

Includes FY2026 so far: $2.13M, still being reported

Subcontracts it reported, on contracts active FY2021–FY2026

$200K

2 subcontractors

About

From the company's SBA profile, updated Oct 2026

1Aardvark is a HUBZone-certified, Service-Disabled Veteran-Owned Small Business specializing in mission-critical software, algorithms, and systems engineering for defense and space programs. We design and deliver resilient, distributed, and secure solutions spanning BMC3, missile warning/defense, space domain awareness, SIGINT, and real-time embedded systems. Our team brings deep expertise in DevSecOps, cloud and edge processing, physics-informed analytics, and consensus-driven distributed architectures. We also provide cleared engineering staff augmentation, procurement services, and full capture-to-delivery consulting. 1Aardvark accelerates mission impact through agile execution, technical excellence, and operationally grounded engineering.

Prime contract obligations by fiscal year, US$, FY2023–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY23$804KFY24FY25FY26$2.13M so far

Insight Largest year: $804K in FY2023. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. California$1.93M · 61%
  2. Virginia$1.22M · 39%
  3. Alabama$500 · 0.0%
Circle area = dollarsOutlined: head office state (Virginia)

Insight 61% was performed in California. See more on the Contracts tab