Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Acquisition Systems Associates, Inc.Report or remove this logo

Acquisition Systems Associates, Inc. Federal Contracts

Correct this listing

Doing business as ACQUISITION SYSTEMS ASSOCIATES INC

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary NFSMX4DLZ9G8· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 651A7· GREAT FALLS, VA· Active registration until Oct 23, 2026· www.acqsys.com (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyArmy$1.69MNavy$500W6QK ACC-RI-PICATINNY (W15QKN)$1.69M · Army officeNSWC DAHLGREN (N00178)$500 · Navy officeAcquisition Systems Associates, Inc.$1.69M
Awards toSubcontracts toCircle area = dollars

Insight W6QK ACC-RI-PICATINNY (W15QKN) is its largest buyer. See more on the Buyers tab

2 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2014–FY2026

$1.69M

Subcontracts it received

$3.21M

from 2 primes

About

From the company's SBA profile, updated Oct 2025

ASA is a recognized, valued, preferred provider of weapon domain and functional expertise. Our staff demonstrated capability of fielding many weapons systems in use today. We support the entire life cycle from requirements development and analysis through the acquisition process to include research, development, test and evaluation, production, and deployment. We offer weapons system domain expertise. Our Domains include: Ammunition, C4ISR systems, Directed Energy, DoD Architectures, Electronic Warfare, Healthcare IT, Missiles, Production and deployment, RDT&E, Space, tracked armored vehicles, test and evaluation, Unmanned Aerial Vehicles, Wheeled vehicles, ASA functional capabilities include: Concept of Operations development, ISR, weapons life cycle, requirements development, analysis, weapons acquisition process, weapons fielding, Mission Engineering, Acquisition Program Management, Schedule Risk analysis, Systems Engineering/ Integration, SETA.

Prime contract obligations by fiscal year, US$, FY2014–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY14FY15FY21FY22FY23FY24$739KFY25FY26$0 so far

Insight Largest year: $739K in FY2024. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Virginia$1.6M · 95%
  2. New Jersey$89.9K · 5.3%
Circle area = dollarsOutlined: head office state (Virginia)

Insight 95% was performed in Virginia. See more on the Contracts tab