Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Adaptivevets Solutions, Inc. Federal Contracts

Correct this listing

Doing business as ADAPTIVEVETS SOLUTIONS INC

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary PJLRFHY1LLS9· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 81K16· DAYTONA BEACH, FL· Active registration until Jul 14, 2027· www.adaptivevets.com (opens in a new tab)

Overview

Buyers, Adaptivevets Solutions and its subcontractors, US$, contracts active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026; subcontractors: reported value since award

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companySubcontractorsVeterans Affairs$10.1MTECHNOLOGYACQUISITION CENTER NJ(36C10B)$10.1M · Veterans Affair…Adaptivevets Solutions,Inc.$10.1MAdaptivestack Technologies Inc.$3.72M
Awards toSubcontracts toCircle area = dollars

Insight TECHNOLOGY ACQUISITION CENTER NJ (36C10B) is its largest buyer. See more on the Buyers tab

1 buying officeAll 1 subcontractors

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2023–FY2026

$10.1M

Includes FY2026 so far: $786K, still being reported

Subcontracts it reported, on contracts active FY2021–FY2026

$3.72M

1 subcontractors

Subcontracts it received

$3.84M

from 3 primes

About

From the company's SBA profile, updated Jul 2026

AdaptiveVets Solutions is a software company comprised of a network of technology and business professionals spanning both federal and private sector markets. Our team prides itself in delivering the innovative products on time and within budget. Our experience in healthcare, defense and other areas gives us the capability to go into a project and make significant impact in a short period of time. We pride ourselves on being Adaptive to technologies, software development lifecycles, processes and procedures within a given business domain, whether it be federal or private. Our core areas are: Research & Design, Product Development, Operations & Maintenance for Government software.

Prime contract obligations by fiscal year, US$, FY2023–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY23FY24$6.43MFY25FY26$786K so far

Insight Largest year: $6.43M in FY2024. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. District of Columbia$4.06M · 40%
  2. Florida$3.34M · 33%
  3. Colorado$1.96M · 19%
  4. Missouri$708K · 7.0%
Circle area = dollarsOutlined: head office state (Florida)

Insight 40% was performed in District of Columbia. See more on the Contracts tab