Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Advanced Systems Technology Inc.Report or remove this logo

Advanced Systems Technology Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary NL2HVM3GT741· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 3J515· LAWTON, OK· Active registration until Aug 16, 2027· www.astcorp.com (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyArmy$29.6MNavy$500W6QK ACC-APG-ORLANDO (W900KK)$29.6M · Army officeNSWC DAHLGREN (N00178)$500 · Navy officeAdvanced Systems Technology Inc.$29.6M
Awards toSubcontracts toCircle area = dollars

Insight W6QK ACC-APG-ORLANDO (W900KK) is its largest buyer. See more on the Buyers tab

2 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2001–FY2026

$180M

Subcontracts it received

$7.92M

from 5 primes

About

From the company's SBA profile, updated Aug 2026

Systems engineering and integration, Systems Research, Requirements Analysis, Live-Virtual-Constructive (LVC) training domain support, conduct of simulation driven exercises and analytical studies pertaining to combat operations and homeland defense, Multi-Service Systems Training Aids, Devices, Simulators, and Simulations (TADSS) development and support services, Combat Training Center (CTC) range operations infrastructure support including construction, refurbishment, and deconstruction of communication towers and supporting equipment, antenna installation, communications cabling, and fiber optic backbone upgrades.

Prime contract obligations by fiscal year, US$, FY2001–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY01FY03$32.7MFY05FY07FY09FY11FY13FY15FY17FY19FY21FY24$0

Insight Largest year: $32.7M in FY2004; since FY2021, $4.55M in FY2021. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$29.6M since award = $5.3M in FY2021–FY2026 + $24.3M before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Louisiana$29.6M · 99%
  2. Oklahoma$500 · 0.0%
Circle area = dollarsOutlined: head office state (Oklahoma)

Insight 99% was performed in Louisiana. See more on the Contracts tab