Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Agil3 Technology Solutions LLCReport or remove this logo

Agil3 Technology Solutions LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary JK6QQLVXC447· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 6TJN3· FALLS CHURCH, VA· Active registration until Jul 28, 2027· www.agil3tech.com (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyArmy$24.3MDefense InformationSystems Agency$8.59MState$7.92M4 more$8.7MW6QM MICC FT LEE (W91QF5)$17.5M · Army officeACQUISITIONS - INL (191NLE)$7.92M · State officeIT CONTRACTING DIVISION - PL83(HC1028)$7.68M · Defense Information Systems…8 more offices$16.4MAgil3 Technology Solutions LLC$49.5M
Awards toSubcontracts toCircle area = dollars

Insight W6QM MICC FT LEE (W91QF5) is its largest buyer. See more on the Buyers tab

11 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2016–FY2026

$52.3M

Includes FY2026 so far: $2.19M, still being reported

Subcontracts it received

$8.3M

from 8 primes

About

From the company's SBA profile, updated Jul 2026

Agil3 Technology Solutions (A3T) is an IT Digital Modernization, Cybersecurity, Emerging Technology, and Professional Services provider to the U.S. Federal Government agencies. We are comprised of qualified, certified, and cleared professionals with highly sought-after technical expertise, supporting geographically dispersed clients in both public and private sectors. Combined with Industry best practices, performance assurance, quality and risk management approaches, A3T provides enterprise–level IT, and delivers classified and unclassified full lifecycle Cybersecurity operations, Data Analytics, Identity & Access Management, RMF Implementation / Security Control Assessments, Cross Domain Solutions, Cloud Support, Help Desk, IT infrastructure, Software and Applications Development, Big Data (Artificial Intelligence/Machine Learning), SharePoint, Web, Systems and Network Engineering, Administration, Architecture Design, and Security solutions to our customers.

Prime contract obligations by fiscal year, US$, FY2016–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY16FY17FY18FY19FY20FY21$9.55MFY22FY23FY24FY25FY26FY26 so far: $2.19M

Insight Largest year: $9.55M in FY2021. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$49.5M since award = $28.2M in FY2021–FY2026 + $21.3M before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Virginia$17.5M · 35%
  2. District of Columbia$13.6M · 27%
  3. Alabama$7.68M · 16%
  4. Georgia$6.71M · 14%
  5. Ohio$2.02M · 4.1%

3 smaller, $2.02M together.

Circle area = dollarsOutlined: head office state (Virginia)

Insight 35% was performed in Virginia. See more on the Contracts tab