Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Agile Data Decisions, Inc.Report or remove this logo

Agile Data Decisions, Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary ZMBDULP64AJ3· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 7PJ28· HOUSTON, TX· Active registration until Apr 23, 2027· agiledd.ai (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyAir Force$1.55MOffice of ProcurementOperations$171KFA8649 USAF SBIR STTR CNTRCTNGAFRL$1.55M · Air Force officeSCI TECH ACQ DIV (70RSAT)$171K · Office of Procurement Operatio…Agile Data Decisions, Inc.$1.72M
Awards toSubcontracts toCircle area = dollars

Insight FA8649 USAF SBIRSBIR: a federal program that funds small businesses to research and develop new technology, in phases, with a path to government sales. Glossary STTRSTTR: like SBIR, but the small business must team with a university or nonprofit research institution on the work. Glossary CNTRCTNG AFRL is its largest buyer. See more on the Buyers tab

2 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2020–FY2026

$1.77M

About

From the company's SBA profile, updated Apr 2026

Our AI platform - iQC - unlocks organizational intelligence and information from technical documents to de-risk business and mission decisions. The platform is being utilized by water management, energy and mining companies and its development has been supported by the US Air Force. iQC has the following key differentiating features: 1. iQC learns domain-specific context from users or subject matter experts (SMEs) with an intuitive point-and-click graphical user interface (GUI). This enables iQC to be utilized rapidly in new use cases and difficult domains. 2. iQC supports numerous unstructured documents include PDFs, MS Office documents, images, and plain text files. 3. It is a containerized platform that utilizes multiple state-of-the-art machine learning and deep learning algorithms for learning domain jargon and context. 4. iQC captures heterogeneous data from documents such as numerical or textual values of attributes, tabular data, key sentences, and visual objects

Prime contract obligations by fiscal year, US$, FY2020–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY20FY21FY22$800KFY23FY24FY26$0 so far

Insight Largest year: $800K in FY2022. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Texas$1.72M · 100%
Circle area = dollarsOutlined: head office state (Texas)

Insight 100% was performed in Texas. See more on the Contracts tab