Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Air Clear, LLC Federal Contracts

Correct this listing

Doing business as AIR CLEAR LLC

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary NN69CL6RDD65· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 8CNF6· ELKTON, MD· Active registration until Dec 16, 2026· WWW.AIRCLEAR.NET (opens in a new tab)

Overview

Buyers and offices that award Air Clear prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyUnited States Mint$869KUS MINT HEADQUARTERS (2031JG)$869K · United States Mint officeAir Clear, LLC$869K
Awards toSubcontracts toCircle area = dollars

Insight US MINT HEADQUARTERS (2031JG) is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2019–FY2026

$869K

Subcontracts it received

$1.96M

from 1 prime

About

From the company's SBA profile, updated Dec 2025

Air Clear is an industrial air pollution control equipment manufacturing company that provides products worldwide. With over 30 years in the industry, we have worked with a variety of industrial manufacturing companies; providing custom Thermal Oxidizers (Regenerative (RTO), Recuperative, afterburners); Catalytic Oxidizers, Fiberbed Filter Systems; pre-filters and heat exchangers. We are a leader in industrial air pollution control equipment design and manufacturing and have worked closely with Government Projects such as; The Philadelphia Mint, Aberdeen Proven Grounds, and General Dynamics. Other industries include Pharmaceutical, Textile Manufacturing, Asphalt Roofing & Shingles Manufacturing, Soil Remediation, Food Manufacturing, Land-Fill Gas Treatment and many other industries worldwide. In addition, our field service technicians are available for installation services on all turnkey style projects and 24/7 emergency services - for more information visit www.airclear.net.

Prime contract obligations by fiscal year, US$, FY2019–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY19$807KFY20FY21$16.8K

Insight Largest year: $807K in FY2019; since FY2021, $16.8K in FY2021. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$869K since award = $16.8K in FY2021–FY2026 + $852K before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Pennsylvania$869K · 100%
Circle area = dollarsOutlined: head office state (Maryland)

Insight 100% was performed in Pennsylvania. See more on the Contracts tab