Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Alethia Software Solutions LLCReport or remove this logo

Alethia Software Solutions LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary HQ8FUFDHB218· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 8LP49· COLORADO SPRINGS, CO· Active registration until Mar 30, 2027· alethia.software (opens in a new tab)

Part of Alethia Software Solutions LLC (opens another page) (parent company) · The parent company's own registration, one of 2

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyMissile Defense Agency$500MISSILE DEFENSE AGENCY (MDA)(HQ0859)$500 · Missile Defense Agency officeAlethia Software Solutions LLC$500
Awards toSubcontracts toCircle area = dollars

Insight MISSILE DEFENSE AGENCY (MDA) (HQ0859) is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2026

$500

Includes FY2026 so far: $500, still being reported

About

From the company's SBA profile, updated Apr 2026

8(a), WOSB. Alethia Software is a Colorado Springs–based mission software firm delivering secure, scalable solutions across SATCOM, Electronic Warfare, Cyber, ISR, PNT, and Space Domain Awareness. We build full-stack, microservice-based systems with engineering-grade user interfaces that fuse complex data into actionable operational intelligence. CertiField, our AI-enabled ATO/RMF accelerator product, unifies STIGs, scans, POA&Ms, and documentation into one platform, reducing time to ATO, improving risk visibility, and enabling continuous, cATO-ready compliance. Past performance includes RF signal monitoring solutions for Kratos and DoD missions; an AI/ML-powered Spectrum Viewer with real-time analysis, geolocation, and EMI alerting; a Data Management Utility for the NSTTC Range Management System for test/evaluation; and a sim-over-live capability for AFTENCAP.

Prime contract obligations by fiscal year, US$, FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY26$500 so far

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Alabama$500 · 100%
Circle area = dollarsOutlined: head office state (Colorado)

Insight 100% was performed in Alabama. See more on the Contracts tab