Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Amphp Inc. Federal Contracts

Correct this listing

Doing business as MOMENTOUS

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary Q5M8EX119NG3· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 88S10· PARK CITY, UT· Active registration until Jan 25, 2027· www.livemomentous.com (opens in a new tab)

Overview

Buyers and offices that award Amphp prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyAir Force$1.72MFA8649 USAF SBIR STTR CNTRCTNGAFRL$1.72M · Air Force officeAmphp Inc.$1.72M
Awards toSubcontracts toCircle area = dollars

Insight FA8649 USAF SBIRSBIR: a federal program that funds small businesses to research and develop new technology, in phases, with a path to government sales. Glossary STTRSTTR: like SBIR, but the small business must team with a university or nonprofit research institution on the work. Glossary CNTRCTNG AFRL is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2020–FY2026

$1.82M

About

From the company's SBA profile, updated Jan 2026

Momentous is a world-class human performance company, focused on pushing the boundaries of human capabilities through innovation, optimization, and personalization. We are the first and only brand in the category to design our products directly with experts from each of the four major pro leagues (NFL, NHL, NBA, MLB). We have products on market that range from biotech-enabled transdermal sodium bicarbonate delivery to whey protein, creatine, and omega-3s. Our flagship product, PR Lotion, has an issued US patent and is cleared by the FDA as an over-the-counter drug. All Momentous products are certified under one or more clean sport regulatories including NSF, Informed-Sport, or Informed-Choice. Our history with the Department of Defense includes product usage and adoption at USSOCOM units such as USASOC, NSW, and AFSOC alongside conventional force usage and application, as well as MAJCOM investigation from the U.S. Army Combat Capabilities Development Center (DEVCOM).

Prime contract obligations by fiscal year, US$, FY2020–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY20FY22$1.65MFY23$74.9K

Insight Largest year: $1.65M in FY2022. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Utah$1.72M · 100%
Circle area = dollarsOutlined: head office state (Utah)

Insight 100% was performed in Utah. See more on the Contracts tab