Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Angarai International, Inc.Report or remove this logo

Angarai International, Inc. federal contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary H1NNGX3K81S1· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 37KR2· College Park, MD· Active registration until Sep 11, 2027· www.angarai.com (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyArmy$1.99MW6QK ACC-APG DIR (W91ZLK)$1.99M · Army officeAngarai International, Inc.$1.99M
Awards toAngarai International, Inc.ConnectedCircle area = dollars

Insight W6QK ACC-APG DIR (W91ZLK) is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2007–FY2026

$6.13M

Includes FY2026 so far: $575K, still being reported

About

From the company's SBA profile, updated Sep 2026

ANGARAI's Services & Solutions expertise: PMO-Project Management Office (Project Management, Program, Management, Construction Management, Program Integrity) TMO-Transformation Management Office (Enterprise Architecture, Organizational Development, Business Process Management, Knowledge Management) AMO-Advisory Management Office (Strategic Management, Management Consulting, Executive Leadership Support, Innovation & Value) QMO-Quality Management Office (Collaborative IV and V and QA/QC, Oversight Services, Integrated GC and RM, Metrics and Dashboards ANGARAI's Industry expertise: Federal, State and Local agencies, Private Sector and Global entities ANGARAI's Domain expertise: Health and Human Services; Transportation and Infrastructure; Defense and Security

Prime contract obligations by fiscal year, US$, FY2007–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY07$2.7MFY13FY15FY17FY19FY23FY26$575K so far

Insight Largest year: $2.7M in FY2007; since FY2021, $575K in FY2025. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Maryland$1.99M · 100%
Circle area = dollarsOutlined: head office state (Maryland)

Insight 100% was performed in Maryland. See more on the Contracts tab