Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Anote, Inc.Report or remove this logo

Anote, Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary FV9GVYUPCHJ8· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 9ZYX7· NEW YORK, NY· Active registration until Mar 31, 2027· anote.ai (opens in a new tab)

Overview

Buyers and offices that award Anote prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyAir Force$268KFA8604 AFLCMC PZI$150K · Air Force officeFA2384 USAF AFMC AFRL PZL AFRLRAKH$118K · Air Force officeAnote, Inc.$268K
Awards toSubcontracts toCircle area = dollars

Insight FA8604 AFLCMC PZI is its largest buyer. See more on the Buyers tab

2 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2025–FY2026

$268K

Includes FY2026 so far: $99.9K, still being reported

About

From the company's SBA profile, updated Apr 2026

Anote is an end to end MLOps platform that enables you to obtain the best large language model for your data. On Anote, we provide an evaluation framework to compare zero shot LLMs like GPT, Claude, Llama3 and Mistral, with fine tuned LLMs that are trained on your domain specific training data (via supervised, unsupervised and RLHF fine tuning). We provide a data annotation interface to convert raw unstructured data into an LLM ready format, and incorporate subject matter expertise into your training process to improve model accuracies. End users can route / integrate the best LLM into their own, on premise, private chatbot, as well as interact with our software development kit for fine tuning.

Prime contract obligations by fiscal year, US$, FY2025–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY25$168KFY26$99.9K so far

Insight Largest year: $168K in FY2025. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. New York$160K · 60%
  2. Nevada$108K · 40%
Circle area = dollarsOutlined: head office state (New York)

Insight 60% was performed in New York. See more on the Contracts tab