Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Aptagen LLCReport or remove this logo

Aptagen LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary HEK9BF17MKL3· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 436H7· JACOBUS, PA· Active registration until Mar 4, 2027· www.aptagen.com (opens in a new tab)

Overview

Buyers and offices that award Aptagen prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyCenters for DiseaseControl and Prevention$1.2MDefense Health Agency$194KFood and DrugAdministration$100K1 more$75KCDC OFFICE OF ACQUISITION SERVICES(75D301)$1.2M · Centers for Disease Control and…ARMY MED RES ACQ ACTIVITY (HT9425)$194K · Defense Health Agency officeFDA OFFICE OF ACQ GRANT SVCS(75F401)$100K · Food and Drug Administration of…1 more offices$75KAptagen LLC$1.57M
Awards toSubcontracts toCircle area = dollars

Insight CDC OFFICE OF ACQUISITION SERVICES (75D301) is its largest buyer. See more on the Buyers tab

4 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2015–FY2026

$1.74M

Subcontracts it received

$114K

from 1 prime

About

From the company's SBA profile, updated Mar 2026

Aptagen, LLC is a biotechnology and life-sciences company. We are a global leader in developing ‘synthetic antibodies’ called aptamers, with over 25 years of experience. Aptamers are target-recognition elements with high affinity and specificity against targets such as small molecules, protein biomarkers, cells, and tissues. Aptamers are an alternative platform to that of antibodies for diagnostic, therapeutic, and bio-industrial applications.

Prime contract obligations by fiscal year, US$, FY2015–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY15FY18FY19$989KFY20FY21FY22FY24FY25$194K

Insight Largest year: $989K in FY2019; since FY2021, $215K in FY2021. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$1.57M since award = $581K in FY2021–FY2026 + $989K before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Pennsylvania$1.38M · 88%
  2. Maryland$194K · 12%
Circle area = dollarsOutlined: head office state (Pennsylvania)

Insight 88% was performed in Pennsylvania. See more on the Contracts tab