Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Avathon Government, Inc.Report or remove this logo

Avathon Government, Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary TBL7YJPTJP99· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 8RBR3· AUSTIN, TX· Active registration until Jan 28, 2027· avathongov.com (opens in a new tab)

Part of Sparkcognition Inc. (opens another page) (parent company) · One of 2 registrations

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyDefense ContractManagement Agency$6.3MArmy$2.19MNavy$1.59M2 more$3,300DCMA SOUTH (S0107A)$6.3M · Defense Contract Management…W6QK ACC- DTA (W912CH)$2M · Army officeNAVSEA HQ (N00024)$1.35M · Navy office5 more offices$443KAvathon Government, Inc.$10.1M
Awards toSubcontracts toCircle area = dollars

Insight DCMADCMA: the Defense agency that manages contracts after award: payments, quality checks, property and contractor business systems. Glossary SOUTH (S0107A) is its largest buyer. See more on the Buyers tab

8 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2021–FY2026

$10.1M

Includes FY2026 so far: $500, still being reported

About

From the company's SBA profile

We Enable Mission Readiness. Avathon harnesses proven AI technology to bolster military readiness, improve decision advantage, and optimize defense operations. Backed by a decade of successful commercial deployments, we provide practical, readiness-focused solutions to upskill maintainers and leverage predictive analytics, partner with the armed forces to enhance domain awareness and decision making, and enable modernization of the defense industrial base by optimizing capital equipment uptime, predicting engine failures, and strengthening supplier quality through advanced technologies like dep learning NLP, generative AI, and computer vision.

Prime contract obligations by fiscal year, US$, FY2021–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY21FY22FY23$4.86MFY24FY25FY26$500 so far

Insight Largest year: $4.86M in FY2023. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Texas$10.1M · 99%
  2. Ohio$1,000 · 0.0%
  3. Alabama$500 · 0.0%
Circle area = dollarsOutlined: head office state (Texas)

Insight 99% was performed in Texas. See more on the Contracts tab