Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Avosys Technology, Inc.Report or remove this logo

Avosys Technology, Inc. Federal Contracts

Correct this listing

Doing business as AVOSYS TECHNOLOGY INC

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary ZHFTV6M8F2W9· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 663X1· SAN ANTONIO, TX· Active registration until Sep 17, 2027· www.avosys.com (opens in a new tab)

Overview

Buyers and offices that award Avosys Technology prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyAir Force$62.3MDefense Health Agency$40MArmy$3.02M1 more$130KFA4877 355 CONS PK$39.9M · Air Force officeDEFENSE HEALTH AGENCY (HT9406)$24.3M · Defense Health Agency officeDEFENSE HEALTH AGENCY (HT9407)$8.39M · Defense Health Agency office21 more offices$32.9MAvosys Technology, Inc.$106M
Awards toSubcontracts toCircle area = dollars

Insight FA4877 355 CONS PK is its largest buyer. See more on the Buyers tab

24 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2012–FY2026

$153M

Includes FY2026 so far: $6.04M, still being reported

Subcontracts it received

$2.66M

from 2 primes

About

From the company's SBA profile, updated Sep 2026

Award winning 8(a), HUBZone, SDB/MBE, CMMI L3 SVC/DEV, JCAHO, ISO 9001, ISO 27001, Microsoft Certified, IT, Cyber/Intel, Medical/Staffing, Financial, Health R&D, DCAA Audited, 100+ cross-domain projects and clients since 1998, Cloud Data Center Hosting, Software & Systems Engineering, Databases, NetOps, Cyber Security, Mobile, Telecomm, eLearning, Instructors, Specialty providers, Physicians, Nurses, Techs, Admins.

Prime contract obligations by fiscal year, US$, FY2012–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY12FY14FY16FY18FY20FY22$18MFY24FY26FY26 so far: $6.04M

Insight Largest year: $18M in FY2023. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$106M since award = $75.7M in FY2021–FY2026 + $29.8M before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Arizona$39.9M · 38%
  2. Virginia$30.4M · 29%
  3. Texas$19.1M · 18%
  4. Nevada$4.54M · 4.3%
  5. North Carolina$2.17M · 2.1%

12 smaller, $9.49M together.

Circle area = dollarsOutlined: head office state (Texas)

Insight 38% was performed in Arizona. See more on the Contracts tab