Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Bellator Group Inc. Federal Contracts

Correct this listing

Doing business as BELLATOR GROUP INC

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary NEMKLJ84H966· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 55NZ0· LEESBURG, VA· Active registration until Oct 23, 2026

Overview

Buyers and offices that award Bellator Group prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyState$1.85MArmy$659KACQUISITIONS - AQM MOMENTUM(19AQMM)$1.85M · State officeW6QM MICC-FT KNOX (W9124D)$659K · Army officeBellator Group Inc.$2.51M
Awards toSubcontracts toCircle area = dollars

Insight ACQUISITIONS - AQM MOMENTUM (19AQMM) is its largest buyer. See more on the Buyers tab

2 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2018–FY2026

$14.6M

Subcontracts it received

$2.13M

from 1 prime

About

From the company's SBA profile, updated Oct 2025

Bellator Group is a HUBZone small business providing services to the Military, Federal Government, and Private Sector. Our core competencies include Intelligence services, where we have developed experienced personnel at all levels of the Intelligence domain both CONUS and OCONUS, including but not limited to CI, OSINT, SIGINT, and All-Source experts. Bellator Group also offers Training Services, providing expert subject matter in training development and administrative support as well as technical, medical, tactical, and everything in between. Another strong competency is our Travel and Logistics Services where we provide corporate and government travel as well as lodging, transportation, and logistics for the Military and Federal Government. Finally, Bellator Group specializes in Equipment Purchasing and Fulfillment Services for the Federal Government ranging offering fulfillment solutions as a supplier of complete tactical and support gear for tactical gear.

Prime contract obligations by fiscal year, US$, FY2018–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY18$6.96MFY19FY20FY21FY22FY23FY24FY25FY26$0 so far

Insight Largest year: $6.96M in FY2018; since FY2021, $1.06M in FY2021. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$2.51M since award = $1.88M in FY2021–FY2026 + $633K before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Montana$568K · 23%
  2. Texas$89K · 3.5%
  3. Illinois$1,500 · 0.1%

No US state recorded: $1.85M · 74%

Circle area = dollarsOutlined: head office state (Virginia)

Insight 86% was performed in Montana. See more on the Contracts tab