Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Bio-synthesis, Inc.Report or remove this logo

Bio-synthesis, Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary MWJBT69QFLH4· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 1EKY7· LEWISVILLE, TX· Active registration until Sep 18, 2027· www.biosyn.com (opens in a new tab)

Overview

Buyers and offices that award Bio-synthesis prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyNational Institutes ofHealth$53.4KNATIONAL INSTITUTES OF HEALTH NIDA(75N950)$31.9K · National Institutes of Health of…NATIONAL INSTITUTES OF HEALTH NIAID(75N930)$10.9K · National Institutes of Health of…NATIONAL INSTITUTES OF HEALTH NHLBI(75N920)$10.6K · National Institutes of Health of…Bio-synthesis, Inc.$53.4K
Awards toSubcontracts toCircle area = dollars

Insight NATIONAL INSTITUTES OF HEALTH NIDA (75N950) is its largest buyer. See more on the Buyers tab

3 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2001–FY2026

$818K

About

From the company's SBA profile, updated Sep 2026

Core Services  Oligonucleotide synthesis  Peptide synthesis  Antibody production  Bio-conjugation services  Organic synthesis  Molecular Biology Services (Cloning, Protein Expression and SNP Genotyping)  Analytical services (MS, HPLC, GC, AAA, Sequencing, Etc.)  Complex oligonucleotide synthesis and modifications o Complex oligonucleotide constructs with multiple labels o Chemical DNA (up to 300 bases), RNA (up to 200 bases) o Ultra long RNA Transcripts >3000 nucleotides o Multi-gram DNA and RNA oligomer production o Oligonucleotide-biomolecule or small molecule conjugates (siRNA-peptide conjugates, DNA-peptides, RNA-peptide conjugates) o Exclusive provider of a novel nucleic acid analog, namely BNA (bridged nucleic acid) Complex peptide synthesis and modifications o Custom peptide synthesis up to 150 amino acids o Large volume peptide manufacturing facility o Large scale peptide production o Peptide-biomolecule or small molecule conjugates Antibody and protein engineering

Prime contract obligations by fiscal year, US$, FY2001–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY01FY04$125KFY06FY08FY10FY12FY14FY16FY18FY22FY25$10.6K

Insight Largest year: $125K in FY2005; since FY2021, $28.1K in FY2022. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$53.4K since award = $42.4K in FY2021–FY2026 + $11K before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Texas$53.4K · 100%
Circle area = dollarsOutlined: head office state (Texas)

Insight 100% was performed in Texas. See more on the Contracts tab