Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Boarhog, LLC Federal Contracts

Correct this listing

Doing business as BOARHOG LLC

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary KT46J86RFFE7· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 6RNC5· SAN DIEGO, CA· Active registration until Mar 13, 2027· www.BoarhogLLC.com (opens in a new tab)

Overview

Buyers and offices that award Boarhog prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyNavy$500NSWC DAHLGREN (N00178)$500 · Navy officeBoarhog, LLC$500
Awards toSubcontracts toCircle area = dollars

Insight NSWC DAHLGREN (N00178) is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2014–FY2026

$986K

Subcontracts it received

$22.1M

from 11 primes

About

From the company's SBA profile, updated Sep 2026

13 years delivering cleared and credentialed Systems Engineering and Technical Assistance (SETA) and Professional Support Services (PSS) to Defense Industrial Base (DIB) clients in 6 states supporting national security organizations to include but not limited to the U.S. military, principally but not exclusively within the Maritime Domain. TS Facility Security Clearance, DCAA approved accounting system, DCSA inspected security system awarded a grade of Commendable.

Prime contract obligations by fiscal year, US$, FY2014–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY14FY15FY16$497KFY17FY19FY24$0

Insight Largest year: $497K in FY2016; since FY2021, $0 in FY2024. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$500 since award = $0 in FY2021–FY2026 + $500 before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. California$500 · 100%
Circle area = dollarsOutlined: head office state (California)

Insight 100% was performed in California. See more on the Contracts tab