Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
C6i Services Corp.Report or remove this logo

C6i Services Corp. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary UYHGNRCXD298· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 6YDX3· CHESTERFIELD, NJ· Active registration until Aug 23, 2027· c6iservices.com (opens in a new tab)

Overview

Buyers and offices that award C6i Services prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyArmy$1.46MVeterans Affairs$41.2KMissile Defense Agency$5000413 AQ HQ RCO-HI (W912CN)$1.36M · Army officeW6QK ACC-APG (W91CRB)$103K · Army office247-NETWORK CONTRACT OFFICE 7(36C247)$41.2K · Veterans Affairs office1 more offices$500C6i Services Corp.$1.5M
Awards toSubcontracts toCircle area = dollars

Insight 0413 AQ HQ RCO-HI (W912CN) is its largest buyer. See more on the Buyers tab

4 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2019–FY2026

$1.9M

Includes FY2026 so far: −$36K, still being reported

Subcontracts it received

$6.24M

from 4 primes

About

From the company's SBA profile, updated Aug 2026

C6I Services Corp is a Service Disabled Veteran Owned Small Business (SDVOSB) that provides Worldwide Engineering, Software Development, Program/Project Management, Logistics, Training and Professional, Scientific and Technical Services expertise to support USG, DoD and OGA C6I requirements. Our staff consists of talented professionals who have worked side by side with the Warfighter in austere locations worldwide. We leverage this experience to provide solutions that are operational on the Multi-Domain Battlefield. As a small business, our flexibility allows us to provide innovation, adaptability, and critical thinking that are essential for our Customers mission requirements.

Prime contract obligations by fiscal year, US$, FY2019–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY19FY20FY21FY22$1.36MFY24FY25FY26−$36K so far

Insight Largest year: $1.36M in FY2022. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$1.5M since award = $1.14M in FY2021–FY2026 + $366K before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. New Jersey$145K · 9.6%
  2. Alabama$500 · 0.0%

No US state recorded: $1.36M · 90%

Circle area = dollarsOutlined: head office state (New Jersey)

Insight 99% was performed in New Jersey. See more on the Contracts tab