Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Carpet Resources, Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary EJRNLQL35ZA3· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 1BJJ5· GREAT FALLS, VA· Active registration until May 20, 2027· www.carpetresourcesinc.com (opens in a new tab)

Overview

Buyers and offices that award Carpet Resources prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyEnvironmental ProtectionAgency$2.1MAir Force$791KPublic Buildings Service$747K19 more$1.84MCONSTRUCTION, FINANCE,ADMINISTRATIVE & IA DIVISION (68HERF)$1.95M · Environmental Protection Agen…FA3300 42 CONS CC$421K · Air Force officePBS R11 BUILDING SERVICES DIVISIONCENTER 2 (47PM06)$322K · Public Buildings Service office46 more offices$2.79MCarpet Resources, Inc.$5.48M
Awards toSubcontracts toCircle area = dollars

Insight CONSTRUCTION, FINANCE, ADMINISTRATIVE & IA DIVISION (68HERF) is its largest buyer. See more on the Buyers tab

49 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2001–FY2026

$37.6M

Includes FY2026 so far: $2.02M, still being reported

Subcontracts it received

$957K

from 3 primes

About

From the company's SBA profile, updated May 2026

Carpet Resources, Inc. (CRI) is a federally focused commercial flooring contractor specializing in the supply and installation of flooring systems for government, institutional, education, healthcare, hospitality, and commercial facilities nationwide. Since 1996, CRI has delivered turnkey flooring renovation solutions with a strong emphasis on federal procurement compliance, manufacturer-certified installation, schedule adherence, and quality workmanship. The principals of CRI have been actively engaged in federal government flooring contracting since 1979, providing decades of experience supporting complex projects throughout the United States. CRI’s services include demolition, substrate preparation, floor leveling, moisture mitigation coordination, material supply, installation, transitions, wall base, stair treads, and full project management for occupied and phased environments.

Prime contract obligations by fiscal year, US$, FY2001–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY01FY03FY05FY07FY09FY11$3.62MFY13FY15FY17FY19FY21FY23FY26$2.02M so far

Insight Largest year: $3.62M in FY2011; since FY2021, $1.3M in FY2023. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$5.48M since award = $5.04M in FY2021–FY2026 + $441K before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. District of Columbia$2.6M · 47%
  2. Virginia$1.27M · 23%
  3. Alabama$421K · 7.7%
  4. California$257K · 4.7%
  5. Tennessee$245K · 4.5%

10 smaller, $689K together.

Circle area = dollarsOutlined: head office state (Virginia)

Insight 47% was performed in District of Columbia. See more on the Contracts tab