Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Carroll Woods Inc.Report or remove this logo

Carroll Woods Inc. Federal Contracts

Correct this listing

Doing business as CARROLL INTERNATIONAL

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary FXBPFAL7E5N2· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 7HK58· TABOR CITY, NC· Active registration until Jul 22, 2027· www.carrollintl.com (opens in a new tab)

Overview

Buyers and offices that award Carroll Woods prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyDefense InformationSystems Agency$4.63MNavy$1.64MFederal AviationAdministration$1.04M13 more$2.88MTELECOMMUNICATIONS DIVISION-HC1013$4.63M · Defense Information Systems…697DCK REGIONAL ACQUISITIONS SVCS$960K · Federal Aviation Administration…255-NETWORK CONTRACT OFFICE 15(36C255)$523K · Veterans Affairs office45 more offices$4.08MCarroll Woods Inc.$10.2M
Awards toSubcontracts toCircle area = dollars

Insight TELECOMMUNICATIONS DIVISION- HC1013 is its largest buyer. See more on the Buyers tab

48 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2016–FY2026

$17M

Includes FY2026 so far: $213K, still being reported

Subcontracts it received

$2.73M

from 8 primes

About

From the company's SBA profile, updated Aug 2026

Carroll Woods, Inc. dba Carroll International delivers mission-critical communications systems, tactical equipment, and technology solutions to DoD, VA, and civilian federal customers. With 300+ contract awards and a 99% on-time delivery rate, we bring a proven execution record from procurement through installation. Our capabilities span tactical radios (URC-300, CM-300, Silvus), SATCOM/VSAT systems, BlueSky masts, DAS and fiber optic installations, GD-MS Tactical Cross Domain Solutions, rugged computing, cyber-physical protection, and AI solutions. We also distribute the Regenlyst Hydrogel Bandage — a clinically evaluated advanced wound dressing progressing through FDA approval. Former GD-MS Mentor-Protégé (2018–2023). Nunn-Perry Award (2021). GD-MS Supplier of the Year (2020).

Prime contract obligations by fiscal year, US$, FY2016–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY16FY17FY18FY19FY20$4.86MFY21FY22FY23FY24FY25FY26FY26 so far: $213K

Insight Largest year: $4.86M in FY2020; since FY2021, $2.91M in FY2022. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$10.2M since award = $6.99M in FY2021–FY2026 + $3.2M before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. North Carolina$5.62M · 55%
  2. Maryland$535K · 5.3%
  3. Virginia$534K · 5.2%
  4. Texas$476K · 4.7%
  5. Nebraska$439K · 4.3%

17 smaller, $2.56M together.

No US state recorded: $15.9K · 0.2%

Circle area = dollarsOutlined: head office state (North Carolina)

Insight 55% was performed in North Carolina. See more on the Contracts tab