Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Carver Scientific LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary GBERJP2KKZ31· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 9L7Z4· NICEVILLE, FL· Active registration until Jul 10, 2027

Overview

Buyers and offices that award Carver Scientific prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyAir Force$164KFA2541 SSC COMRCL SVS OFC SSC CMK$164K · Air Force officeCarver Scientific LLC$164K
Awards toSubcontracts toCircle area = dollars

Insight FA2541 SSC COMRCL SVS OFC SSC CMK is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2025–FY2026

$164K

About

From the company's SBA profile, updated Jul 2026

Carver Scientific LLC is a professional R&D services company specializing in national security science and fundamental physics research with a focus on nuclear detonation detection phenomenology and high-reliability space and ground systems. Core competencies include scientific software development (C/C++, Java, Python, Fortran, IDL), algorithm development, software verification and validation (V&V), system level modeling and simulation, radiation transport calculations, space domain awareness and space environment analysis, and project/program management.

Prime contract obligations by fiscal year, US$, FY2025–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY25$164K

Insight Largest year: $164K in FY2025. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. New Mexico$164K · 100%
Circle area = dollarsOutlined: head office state (Florida)

Insight 100% was performed in New Mexico. See more on the Contracts tab