Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Caso Law Firm, PLLCReport or remove this logo

Caso Law Firm, PLLC federal contracts

Correct this listing

Doing business as CLF ENTERPRISE

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary FFYZPFAKEJJ5· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 8CRC4· Edinburg, TX· Active registration until Jul 9, 2027· www.clfenterprise.com (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyU.S. Customs and BorderProtection$2.28MArmy$2,500ADMINISTRATION FACILITIES TRAINING…$2.28M · U.S. Customs and Border Prote…W076 ENDIST TULSA (W912BV)$2,500 · Army officeCaso Law Firm, PLLC$2.28M
Awards toCaso Law Firm, PLLCConnectedCircle area = dollars

Insight ADMINISTRATION FACILITIES TRAINING CONTRACTING DIVISION (70B01C) is its largest buyer. See more on the Buyers tab

2 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2026

$2.28M

Includes FY2026 so far: $2.28M, still being reported

About

From the company's SBA profile, updated May 2026

CLF Enterprise provides real estate acquisition, relocation, appraisal, title work, right-of-way, eminent domain, legal, and project management services throughout the United States. Headquartered in south Texas, CLF integrates technical expertise to support federal, state, and local agencies managing complex, compliance-driven infrastructure and land acquisition programs. The firm has advised on more than $5 billion in public infrastructure projects, closed over 250 real estate transactions, and handled more than 100 eminent domain matters. CLF applies a quality control and assurance framework and has a record of on-time, within-budget performance. CLF Enterprise is an SBA 8(a)-certified firm.

Prime contract obligations by fiscal year, US$, FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY26$2.28M so far

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Texas$2.28M · 99%
  2. Oklahoma$2,500 · 0.1%
Circle area = dollarsOutlined: head office state (Texas)

Insight 99% was performed in Texas. See more on the Contracts tab