Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Catalytic Combustion CorporationReport or remove this logo

Catalytic Combustion Corporation federal contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary N3X6PTWGXAT8· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 4SST5· Bloomer, WI· Active registration until Mar 24, 2027· www.catalyticcombustion.com (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyNational Aeronautics andSpace Administration$1,519NASA SHARED SERVICES CENTER(80NSSC)$1,519 · National Aeronautics and Space…Catalytic Combustion Corporation$1,519
Awards toCatalytic Combustion CorporationConnectedCircle area = dollars

Insight NASA SHARED SERVICES CENTER (80NSSC) is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2016–FY2026

$64.5K

No prime awards in FY2026 so far; last obligations in FY2021

Subcontracts it received

$43.3K

from 1 prime

About

From the company's SBA profile, updated Mar 2026

Manufacuring of Air Pollution Control and Abatement Equipment. Remediation Equipment. Process and unit controls including UK 508 Panel Shop. Skid Mount Fabrication of equipment, startup and servicing of equipment. Process Design

Prime contract obligations by fiscal year, US$, FY2016–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY16$63KFY21$1,519

Insight Largest year: $63K in FY2016; since FY2021, $1,519 in FY2021. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Wisconsin$1,519 · 100%
Circle area = dollarsOutlined: head office state (Wisconsin)

Insight 100% was performed in Wisconsin. See more on the Contracts tab