Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Cgrads LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary LZPFXQJY55D7· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 9XKL7· LITTLE ELM, TX· Active registration until May 21, 2027· cgrads.com (opens in a new tab)

Overview

Buyers and offices that award Cgrads prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyMissile Defense Agency$500MISSILE DEFENSE AGENCY (MDA)(HQ0859)$500 · Missile Defense Agency officeCgrads LLC$500
Awards toSubcontracts toCircle area = dollars

Insight MISSILE DEFENSE AGENCY (MDA) (HQ0859) is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2026

$500

Includes FY2026 so far: $500, still being reported

About

From the company's SBA profile, updated Jun 2026

CGRADS, based in Little Elm, Texas, builds advanced AI and data science solutions for education, healthcare, defense, and enterprise clients. We integrate generative AI, quantum computing, and high-performance data systems to solve complex challenges. Our core strengths include predictive modeling, AI/ML compiler optimization, intelligent automation, and real-time data fusion. In education, we develop adaptive learning engines. In healthcare, we use AI and quantum tools for diagnostics and genomic analysis. In defense and aerospace, we create embedded AI for drones and smart projectiles, enabling target recognition and mission control. We design compilers to speed inference on edge hardware. CGRADS stands out for secure data handling, domain-specific AI, and rapid edge-to-cloud deployment. Clients include universities, research institutions, defense contractors, and tech enterprises.

Prime contract obligations by fiscal year, US$, FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY26$500 so far

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Alabama$500 · 100%
Circle area = dollarsOutlined: head office state (Texas)

Insight 100% was performed in Alabama. See more on the Contracts tab