Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Chenega Decision Sciences LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary PN2EBLQ12PH1· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 6ZJX4· LORTON, VA· Active registration until Apr 27, 2027

Part of The Chenega Corporation (opens another page) (parent company) · One of 89 registrations · Company group: Chenega Decision Sciences LLC (2 registrations)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyArmy$81.8MNavy$16.2MFederal EmergencyManagement Agency$6.72M1 more$5.32MW6QK ACC-RI-PICATINNY (W15QKN)$25.8M · Army officeW6QK ACC-RI (W519TC)$20M · Army officeW6QK ACC-APG (W56KGY)$18.8M · Army office4 more offices$45.4MChenega Decision Sciences LLC$110M
Awards toSubcontracts toCircle area = dollars

Insight W6QK ACC-RI-PICATINNY (W15QKN) is its largest buyer. See more on the Buyers tab

7 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2014–FY2026

$181M

Includes FY2026 so far: −$837K, still being reported

About

From the company's SBA profile, updated Jun 2026

Agile Methodology, Business Process, Cloud Services, Configuration Management, Cost Analysis, Cross Domain Solutions, Cybersecurity, Data Analytics, Data Center, DevOps, Enterprise Solutions, FedRAMP. Help Desk, Information Technology, IT Modernization, Networking Engineering, Network Operations, NIST, Post Deployment, Software Development, Sustainment, Systems Engineering, Systems Integration, Risk Management Framework, Testing, Web Development

Prime contract obligations by fiscal year, US$, FY2014–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY14FY16FY18FY20$27.4MFY22FY24FY26−$837K so far

Insight Largest year: $27.4M in FY2020; since FY2021, $20.9M in FY2021. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$110M since award = $35.3M in FY2021–FY2026 + $74.7M before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Virginia$110M · 100%
Circle area = dollarsOutlined: head office state (Virginia)

Insight 100% was performed in Virginia. See more on the Contracts tab