Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Chugach Ignite Solutions JV, LLCReport or remove this logo

Chugach Ignite Solutions JV, LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary WA1HQBJEDX48· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 9ZYW4· ANCHORAGE, AK· Active registration until Jul 9, 2027· www.chugachgov.com (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyNavy$22.3MMissile Defense Agency$500NIWC ATLANTIC (N65236)$22.3M · Navy officeMISSILE DEFENSE AGENCY (MDA)(HQ0859)$500 · Missile Defense Agency officeChugach Ignite Solutions JV, LLC$22.3M
Awards toSubcontracts toCircle area = dollars

Insight NIWC ATLANTIC (N65236) is its largest buyer. See more on the Buyers tab

2 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2026

$22.3M

Includes FY2026 so far: $22.3M, still being reported

About

From the company's SBA profile, updated Sep 2025

Chugach Ignite Solutions JV, LLC, an 8(a) certified Joint Venture, delivers innovative, mission-ready technology solutions that empower operational excellence across defense and federal sectors, both CONUS and OCONUS. Leveraging advance systems integration, digital engineering, and secure communications, we design and implement scalable, cyber-resilient infrastructures that meet evolving mission demands. Our capabilities span command center design, AV lifecycle support, logistics visibility platforms, and rapid prototyping. Through these tailored solutions, Chugach enhances warfighter readiness, strengthens multi-domain command and control, and drives innovation for critical government missions.

Prime contract obligations by fiscal year, US$, FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY26$22.3M so far

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. South Carolina$14.9M · 67%
  2. Alaska$7.35M · 33%
  3. Alabama$500 · 0.0%
Circle area = dollarsOutlined: head office state (Alaska)

Insight 67% was performed in South Carolina. See more on the Contracts tab