Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Cloudstone Innovations Inc.Report or remove this logo

Cloudstone Innovations Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary W2D8JAW5PD67· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 8MTD8· KIHEI, HI· Active registration until Jul 20, 2027· www.cloudstoneinnovations.com (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyAir Force$6.87MFA2541 SSC COMRCL SVS OFC SSC CMK$2.9M · Air Force officeFA9451 AFRL RDK$2.09M · Air Force officeFA8750 AFRL RIK$1.8M · Air Force office1 more offices$75KCloudstone Innovations Inc.$6.87M
Awards toSubcontracts toCircle area = dollars

Insight FA2541 SSC COMRCL SVS OFC SSC CMK is its largest buyer. See more on the Buyers tab

4 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2022–FY2026

$6.87M

Includes FY2026 so far: $1.45M, still being reported

About

From the company's SBA profile, updated Jul 2026

CLOUDSTONE INNOVATIONS LLC (“CLOUDSTONE”) is an aerospace engineering technology company, headquartered in Maui, Hawaii. CLOUDSTONE is a minority-owned HUBZone company organized as a for-profit small business concern. We are both a product-based and service-based company. Our product lines are available for purchase and/or subscription: software as a service (SaaS), data, and equipment. Our services range from consulting, mission engineering, research and development (R&D), modeling and simulation (M&S), integration and testing, to operations and maintenance. We also offer access to a pool of coveted experts in cislunar astrodynamics, imaging science, machine learning (ML), artificial intelligence (AI), optimization theory, internet of things (IoT), cloud computing, DevSecOps, and Space Domain Awareness (SDA).

Prime contract obligations by fiscal year, US$, FY2022–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY22FY23FY24FY25$3.65MFY26$1.45M so far

Insight Largest year: $3.65M in FY2025. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Hawaii$6.87M · 100%
Circle area = dollarsOutlined: head office state (Hawaii)

Insight 100% was performed in Hawaii. See more on the Contracts tab