Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

CLT Solutions 2 LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary SPFGY8GEKDC3· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 8Z3H6· HERNDON, VA· Registration not active until Jun 9, 2026

Overview

Buyers and offices that award CLT Solutions 2 prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyNational Institutes ofHealth$93.8KNATIONAL INSTITUTES OF HEALTH NHLBI(75N920)$93.8K · National Institutes of Health of…CLT Solutions 2 LLC$93.8K
Awards toSubcontracts toCircle area = dollars

Insight NATIONAL INSTITUTES OF HEALTH NHLBI (75N920) is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2024–FY2026

$93.8K

About

From the company's SBA profile, updated Jun 2025

CLT Solution's mission has been to help organizations throughout American government and industry not only survive, but positively thrive amid the unrelenting technological, economic, and cultural change of the modern era. And we bring you every possible advantage to do it: leading edge technologies, tools, and services; Unparalleled domain expertise from across the consulting sphere; A friendlier price point than you’ll find at bigger firms; And most of all, a passionate and enduring commitment to the lasting success of our clients. That’s how we keep your organization alive and kicking, no matter what the future has in store.

Prime contract obligations by fiscal year, US$, FY2024–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY24$93.8KFY25$0

Insight Largest year: $93.8K in FY2024. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Maryland$93.8K · 100%
Circle area = dollarsOutlined: head office state (Virginia)

Insight 100% was performed in Maryland. See more on the Contracts tab