Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Coho Consulting Group LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary QRA3U2RLDFS5· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 9NKU4· CHANTILLY, VA· Active registration until Aug 2, 2027· copperrivermc.com/coho-consulting-group (opens in a new tab)

Part of Native Village Of Eyak (opens another page) (parent company) · One of 30 registrations · Company group: Coho Consulting Group LLC (2 registrations)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyAir Force$1.37MFA8525 AFLCMC WLSKA$1.37M · Air Force officeCoho Consulting Group LLC$1.37M
Awards toSubcontracts toCircle area = dollars

Insight FA8525 AFLCMC WLSKA is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2026

$1.37M

Includes FY2026 so far: $1.37M, still being reported

About

From the company's SBA profile, updated Aug 2026

Coho Consulting Group (CCG) is a premier provider of specialized services, committed to helping organizations navigate complex challenges and achieve strategic goals. Focusing on the United States Air Force (USAF), CCG leverages cutting-edge technologies, domain expertise, and a commitment to continuous improvement to optimize operations, enhance decision-making, and drive mission success. CCG understands the critical nature of the USAF's mission and the dynamic defense environment it operates in. Our solutions align with the Air Force's mission needs, ensuring efficiency, agility, and superior outcomes both short- and long-term. CCG excels in business transformation, process improvement, agile software development, data management, and AI/ML integration. We drive operational efficiency, streamline processes, and foster innovation by modernizing systems, optimizing resources, and implementing data-driven decision-making.

Prime contract obligations by fiscal year, US$, FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY26$1.37M so far

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Georgia$1.37M · 100%
Circle area = dollarsOutlined: head office state (Virginia)

Insight 100% was performed in Georgia. See more on the Contracts tab