Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Compass Technology Group, Inc.Report or remove this logo

Compass Technology Group, Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary C1NAM2AGK7M5· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 6G0N3· ALPHARETTA, GA· Active registration until Jun 20, 2027· compasstech.com (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyAir Force$35.2MNavy$748KDefense ContractManagement Agency$747K3 more$310KFA8571 MAINT CONTRACTING AFSC PZIM$23.3M · Air Force officeFA8650 USAF AFMC AFRL PZLAFRL/PZL$4M · Air Force officeFA2394 USAF AFMC AFRL PZL AFRLRXKM$3.9M · Air Force office9 more offices$5.85MCompass Technology Group, Inc.$37M
Awards toSubcontracts toCircle area = dollars

Insight FA8571 MAINT CONTRACTING AFSC PZIM is its largest buyer. See more on the Buyers tab

12 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2012–FY2026

$43.5M

Includes FY2026 so far: $2.29M, still being reported

Subcontracts it received

$1.91M

from 4 primes

About

From the company's SBA profile, updated Jul 2026

• Expertise in radio frequency (RF) and microwave design and characterization of materials, structures, and antennas • Computational Modeling: our flagship, OpenTDA is a finite difference time domain (FDTD) code used for design and research in materials, antennas and RF devices. CTG also has a computer cluster for high-throughput calculations. • Experimental Measurements and Devices: CTG designs, builds and maintains RF and microwave sensors and devices for use in customer facilities and for contract measurements. CTG is especially known for its wide-band microwave materials measurement technologies (Free-space/focused beam, waveguide, transmission line, specialty devices). CTG also has a commercially available software package for acquiring data and calculating material properties: CTGcalc™ • Robotic Radome testing systems

Prime contract obligations by fiscal year, US$, FY2012–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY12FY14FY17FY19FY21FY23$13.3MFY26FY26 so far: $2.29M

Insight Largest year: $13.3M in FY2024. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$37M since award = $33.6M in FY2021–FY2026 + $3.46M before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Georgia$36.7M · 99%
  2. Maryland$253K · 0.7%
  3. Oklahoma$46.5K · 0.1%
  4. Alabama$45K · 0.1%
Circle area = dollarsOutlined: head office state (Georgia)

Insight 99% was performed in Georgia. See more on the Contracts tab