Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Concurrent Electronic Design Automation LLC Federal Contracts

Correct this listing

Doing business as CONCURRENT EDA

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary CKL8PBGPEEV3· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 4VMF4· PITTSBURGH, PA· Active registration until Mar 18, 2027· www.concurrenteda.com (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyArmy$37.6KNational Institute ofStandards and Technology$11.9KNavy$6,400W6QK ACC-APG ADELPHI (W911QX)$37.6K · Army officeDEPT OF COMMERCE NIST (1333ND)$11.9K · National Institute of Standards…NAVAL UNDERSEA WARFARE CENTER(N00253)$6,400 · Navy officeConcurrent Electronic DesignAutomation LLC$55.9K
Awards toSubcontracts toCircle area = dollars

Insight W6QK ACC-APG ADELPHI (W911QX) is its largest buyer. See more on the Buyers tab

3 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2016–FY2026

$237K

Subcontracts it received

$171K

from 3 primes

About

From the company's SBA profile, updated Mar 2026

High-speed camera systems. FPGA design services, high-performance embedded systems design, CPU/GPU/DSP programming services. Domain expertise: image processing, signal processing, data processing, cryptography, networking, text searching

Prime contract obligations by fiscal year, US$, FY2016–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY16$150KFY17FY20FY21FY23FY24$6,400

Insight Largest year: $150K in FY2016; since FY2021, $37.6K in FY2023. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Maryland$37.6K · 67%
  2. Pennsylvania$6,400 · 11%

No US state recorded: $11.9K · 21%

Circle area = dollarsOutlined: head office state (Pennsylvania)

Insight 85% was performed in Maryland. See more on the Contracts tab