Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Creagen Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary TR7EMJYU1KL9· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 4TEG8· WOBURN, MA· Active registration until Nov 13, 2026· www.creagenbio.com (opens in a new tab)

Overview

Buyers and offices that award Creagen prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyNational Institutes ofHealth$317KDefense Health Agency$105KCenters for DiseaseControl and Prevention$47KNATIONAL INSTITUTES OF HEALTH NICHD(75N940)$174K · National Institutes of Health off…ARMY MED RES ACQ ACTIVITY (HT9425)$105K · Defense Health Agency officeNATIONAL INSTITUTES OF HEALTH NIDA(75N950)$66K · National Institutes of Health offi…4 more offices$124KCreagen Inc.$470K
Awards toSubcontracts toCircle area = dollars

Insight NATIONAL INSTITUTES OF HEALTH NICHD (75N940) is its largest buyer. See more on the Buyers tab

7 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2010–FY2026

$548K

Includes FY2026 so far: $56K, still being reported

About

From the company's SBA profile, updated Nov 2025

CreaGen Inc. provides contract research services in organic synthesis, medicinal chemistry, lead optimization, small molecules, chemical library synthesis, conjugation chemistry, and antibody drug conjugation chemistry, analytical and bio-analytical chemistry. We have more than 100 years of combined experience in working with over 48 biotech and pharmaceutical companies and federal institutes. Our 22,000 sq ft facility has a full suite of infrastructure for synthesis, purification and characterization combined with a highly qualified team of chemists putting us in a strong position to deliver unparalleled drug discovery services to biotech, pharmaceutical companies and Federal research laboratories.

Prime contract obligations by fiscal year, US$, FY2010–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY10FY19FY20FY21FY22FY23$185KFY24FY25FY26$56K so far

Insight Largest year: $185K in FY2023. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Massachusetts$423K · 90%
  2. Georgia$47K · 10%
Circle area = dollarsOutlined: head office state (Massachusetts)

Insight 90% was performed in Massachusetts. See more on the Contracts tab