Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Cygnos Biotech, LLCReport or remove this logo

Cygnos Biotech, LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary PXYDY5CQJDM3· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 8WQ76· MIAMI, FL· Active registration until Dec 23, 2026· www.cygnosbiotech.com (opens in a new tab)

Overview

Buyers and offices that award Cygnos Biotech prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyArmy$1.6MW6QK ACC-APG (W911SR)$1.6M · Army officeCygnos Biotech, LLC$1.6M
Awards toSubcontracts toCircle area = dollars

Insight W6QK ACC-APG (W911SR) is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2025–FY2026

$1.6M

Includes FY2026 so far: $1.4M, still being reported

About

From the company's SBA profile, updated Dec 2025

CYGNOS BioTech, LLC is a U.S.–based small business biotechnology company specializing in the development of virus-agnostic, host-directed antiviral biologics for veterinary and future human use, aligned with One Health and biodefense priorities. The company applies protein biologic engineering, advanced analytical characterization, and AI-assisted structural modeling to enable safe, manufacturable antiviral candidates. CYGNOS leverages an integrated network of academic, CRO, and cGMP manufacturing partners to advance programs from early discovery through preclinical development, regulatory engagement, and pilot clinical evaluation.

Prime contract obligations by fiscal year, US$, FY2025–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY25$204KFY26$1.4M so far

Insight Largest year: $204K in FY2025. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Florida$1.6M · 100%
Circle area = dollarsOutlined: head office state (Florida)

Insight 100% was performed in Florida. See more on the Contracts tab