Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Demil Transport Services, LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary Y7EPJA1YHYQ3· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 95DG3· ANCHORAGE, AK· Active registration until Sep 23, 2027

Part of Calista Corp. (opens another page) (parent company) · One of 55 registrations

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyArmy$125KAir Force$66.3KW7MY USPFO ACTIVITY COANG 140(W50S6V)$125K · Army officeFA4801 49 CONS PK$66.3K · Air Force officeDemil Transport Services, LLC$191K
Awards toSubcontracts toCircle area = dollars

Insight W7MY USPFO ACTIVITY COANG 140 (W50S6V) is its largest buyer. See more on the Buyers tab

2 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2024–FY2026

$191K

Subcontracts it received

$416K

from 1 prime

About

From the company's SBA profile, updated Oct 2026

DTS is the industry leader in range residue recycling (R3) services. We safely and efficiently recycle all range debris ensuring that every item leaving the installation meets DoD requirements for demilitarization. In addition to R3 services, we provide a variety of range operations and maintenance solutions. We also provide a range of forestry services to include mine remediation.

Prime contract obligations by fiscal year, US$, FY2024–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY24$125KFY25FY26$0 so far

Insight Largest year: $125K in FY2024. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Colorado$125K · 65%
  2. New Mexico$66.3K · 35%
Circle area = dollarsOutlined: head office state (Alaska)

Insight 65% was performed in Colorado. See more on the Contracts tab