Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Dynaxys, LLCReport or remove this logo

Dynaxys, LLC Federal Contracts

Correct this listing

Doing business as DYNAXYS LLC

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary FFFSL3E5C792· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 3B4P2· SILVER SPRING, MD· Active registration until Sep 23, 2027· www.dynaxys.com (opens in a new tab)

Overview

Buyers and offices that award Dynaxys prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyHousing and UrbanDevelopment$140MCPO : RESEARCH AND COMMUNITYSUPPOR (866157)$140M · Housing and Urban Development…Dynaxys, LLC$140M
Awards toSubcontracts toCircle area = dollars

Insight CPO : RESEARCH AND COMMUNITY SUPPOR (866157) is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2003–FY2026

$311M

Includes FY2026 so far: $9.59M, still being reported

About

From the company's SBA profile, updated Sep 2026

Dynaxys modernizes operations through AI, intelligent automation, and deep expertise in regulated environments. With 25+ years of experience, we design and deliver secure, scalable software, cloud, and data-driven solutions that streamline processes, reduce risk, and enable better-informed decisions. We combine strong cybersecurity practices, scalable architectures, and domain knowledge in areas such as loan servicing, asset management, accounting, property management, and childcare services. Our approach blends innovation with operational discipline, allowing us to serve as a full-lifecycle partner that turns emerging technologies into practical, measurable outcomes.

Prime contract obligations by fiscal year, US$, FY2003–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY03FY05FY07$22.8MFY09FY11FY13FY15FY17FY19FY21FY23FY26$9.59M so far

Insight Largest year: $22.8M in FY2008; since FY2021, $19.3M in FY2021. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$140M since award = $66M in FY2021–FY2026 + $73.8M before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Maryland$140M · 100%
Circle area = dollarsOutlined: head office state (Maryland)

Insight 100% was performed in Maryland. See more on the Contracts tab