Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Electronic/fasteners, Inc. Federal Contracts

Correct this listing

Doing business as ELECTRONIC FASTENERS INC

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary LTURF8KRMAA9· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 0CRE2· SANFORD, FL· Active registration until Mar 5, 2027· www.elecfast.net (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyDefense Logistics Agency$9,813DLA AVIATION (SPE4A6)$6,961 · Defense Logistics Agency officeDLA AVIATION (SPE4A5)$2,852 · Defense Logistics Agency officeElectronic/fasteners, Inc.$9,813
Awards toSubcontracts toCircle area = dollars

Insight DLA AVIATION (SPE4A6) is its largest buyer. See more on the Buyers tab

2 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2013–FY2026

$127K

Subcontracts it received

$81.7K

from 1 prime

About

From the company's SBA profile, updated Mar 2026

Carries a full line of Mil-Spec and commercial hardware and electronic components in all types of material and plating. Offers specialized bagging, kitting, barcoding, scheduling, JIT/Breadman program,cross referencing to your part number sequence.

Prime contract obligations by fiscal year, US$, FY2013–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY13FY14$56.4KFY15FY16FY17FY18FY21FY22FY23FY25$0

Insight Largest year: $56.4K in FY2014; since FY2021, $4,347 in FY2023. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Florida$9,813 · 100%
Circle area = dollarsOutlined: head office state (Florida)

Insight 100% was performed in Florida. See more on the Contracts tab