Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Esgplus LLC Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary EAYJNN1TYZ25· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 8ZEW0· SUGAR LAND, TX· Active registration until Sep 19, 2027· ESGPlusLLC.com (opens in a new tab)

Overview

Buyers and offices that award Esgplus prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyAgency for InternationalDevelopment$677KUSAID M/OAA (7200AA)$677K · Agency for International Develop…Esgplus LLC$677K
Awards toSubcontracts toCircle area = dollars

Insight USAID M/OAA (7200AA) is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2022–FY2026

$677K

About

From the company's SBA profile, updated Sep 2026

Compliance & Due Diligence: Reviewing Compliance and Due Diligence policies, procedures, and strategy to manage operational risk in the maritime domain. Formulating specific vessel screening criteria. Education and Training of personnel in the Maritime Supply Chain. Guidance on the operational risk associated with various types of vessels in the maritime supply chain. ESG & GHG Emissions: Strengthening corporate governance and compliance process focusing on ESG and resilience. Formulating GHG policy and strategy to reduce carbon footprint and emissions, Quality Marine Assurance: Reviewing the marine assurance process for a resilient and competitive maritime supply chain. Designing and implementing a resilient marine assurance process Assessment of operational risk for a voyage Evaluation of a vessel operator including safety management system Guidance on marine trade specific to vessel types and cargoes Maritime incident investigation and Expert review

Prime contract obligations by fiscal year, US$, FY2022–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY22FY23$370KFY24FY25$0

Insight Largest year: $370K in FY2023. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Texas$545K · 81%

No US state recorded: $132K · 19%

Circle area = dollarsOutlined: head office state (Texas)

Insight 100% was performed in Texas. See more on the Contracts tab