Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Fire Chief Equipment Co. Inc.Report or remove this logo

Fire Chief Equipment Co. Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary QK7LXMS8MB83· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 7Z888· BELLEVUE, WA· Active registration until Jul 28, 2027· www.fire-chief.com (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyFederal EmergencyManagement Agency$62.9KNational Oceanic andAtmosphericAdministration$27.8KNATIONAL CONTINUITY SECTION(CON50)(70FA50)$43.1K · Federal Emergency Managemen…DEPT OF COMMERCE NOAA (1305M3)$27.8K · National Oceanic and Atmospher…INCIDENT SUPPORT SECTION(ISS70)(70FB70)$14.3K · Federal Emergency Managemen…1 more offices$5,566Fire Chief Equipment Co. Inc.$90.7K
Awards toSubcontracts toCircle area = dollars

Insight NATIONAL CONTINUITY SECTION(CON50) (70FA50) is its largest buyer. See more on the Buyers tab

4 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2006–FY2026

$116K

Includes FY2026 so far: $214, still being reported

About

From the company's SBA profile, updated Jul 2026

Fire Chief Equipment specializes in servicing your equipment from an integrated point of view. We eliminate the gray areas between vendor responsibilities and provide the best value for you and your company. Our technicians are certified for all of our products and can supply and service all of your fire protection and fire sprinkler system needs on site. Our comprehensive service includes: Fire Alarm and Detection Systems (Including VESDA Very Early Warning systems) HFC-227ea, FE-227, FM-200, Ecaro 25, Halon 1301 and CO2 systems High Rise Sequence Testing Fire Sprinkler Systems: Installation, Inspection, Restoration Corrosion Prevention for Fire Sprinkler Systerms (learn more here) Fire Pumps and Fire Hoses: Installation, Inspection, Restoration Backflow Tests and Servicing Portable Fire Extinguishers Emergency /Exit Lighting Inspections Restaurant, Industrial and Vehicle Systems Fire Training for Commercial and Industrial Systems

Prime contract obligations by fiscal year, US$, FY2006–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY06FY13FY15FY17FY19FY21$19.3KFY23FY26FY26 so far: $214

Insight Largest year: $19.3K in FY2021. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$90.7K since award = $75K in FY2021–FY2026 + $15.7K before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Washington$90.7K · 100%
Circle area = dollarsOutlined: head office state (Washington)

Insight 100% was performed in Washington. See more on the Contracts tab