Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Forcys Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary DC5VNMMT1FW6· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 9RZT3· ASHBURN, VA· Active registration until Jul 27, 2027· www.forcys.com (opens in a new tab)

Overview

Buyers and offices that award Forcys prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyNavy$262KNAVAL SURFACE WARFARE CENTER(N61331)$189K · Navy officeNUWC DIV NEWPORT (N66604)$72.7K · Navy officeForcys Inc.$262K
Awards toSubcontracts toCircle area = dollars

Insight NAVAL SURFACE WARFARE CENTER (N61331) is its largest buyer. See more on the Buyers tab

2 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2024–FY2026

$262K

Includes FY2026 so far: $189K, still being reported

Subcontracts it received

$14M

from 4 primes

About

From the company's SBA profile, updated Jul 2026

Forcys is a global maritime defense company with 50 years' domain expertise. Backed by our technology partners Sonardyne, Voyis, EIVA, Wavefront Systems, and Chelsea Technologies, we deliver mission-shaped solutions for undersea warfare. We integrate navigation, positioning, optical and acoustic communications, optical and laser imaging, sonar, environmental sensors, and full-spectrum mission software systems for unmanned maritime systems and seafloor sensor networks to meet your needs.

Prime contract obligations by fiscal year, US$, FY2024–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY24$72.7KFY26$189K so far

Insight Largest year: $72.7K in FY2024. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Virginia$262K · 100%
Circle area = dollarsOutlined: head office state (Virginia)

Insight 100% was performed in Virginia. See more on the Contracts tab