Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
G2K Labs Inc.Report or remove this logo

G2K Labs Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary PLDNCWJ4KVS7· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 7VZF9· MC LEAN, VA· Active registration until Dec 10, 2026· www.g2klabs.com (opens in a new tab)

Overview

Buyers and offices that award G2K Labs prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyDrug EnforcementAdministration$16.7MHEADQUATERS (15DDHQ)$16.6M · Drug Enforcement Administrat…OFFICE OF INVESTIGATIVE TECHNOLOGY(15DDST)$53.3K · Drug Enforcement Administrati…G2K Labs Inc.$16.7M
Awards toSubcontracts toCircle area = dollars

Insight HEADQUATERS (15DDHQ) is its largest buyer. See more on the Buyers tab

2 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2019–FY2026

$19.8M

Includes FY2026 so far: $1.87M, still being reported

About

From the company's SBA profile, updated Dec 2025

G2K Labs is an independent and innovative partner for a wide range of IT security solutions. Our approach and solutions support Governments, Agencies, Telecom- and Internet Service Providers to solve nationwide communications and security matters. From our headquarters in Virginia, and our offices in the Netherlands, Norway, Switzerland we organize our operations all over the world. From our regional offices we are flexible and we can quickly respond to the wishes of our customers. G2K Labs focuses to solve your concerns and create value for you, our partners, our employees and shareholders. We support various initiatives at home and abroad, and are as sustainable as possible with energy and natural resources within our organization. G2K Labs delivers and preserves essential and reliable Interception, network protocol and network measurement and provisioning knowledge and has global experience in the public and telecommunication domain.

Prime contract obligations by fiscal year, US$, FY2019–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY19FY20FY21FY22FY23FY24FY25$4.25MFY26$1.87M so far

Insight Largest year: $4.25M in FY2025. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$16.7M since award = $15.9M in FY2021–FY2026 + $739K before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Virginia$16.7M · 100%
Circle area = dollarsOutlined: head office state (Virginia)

Insight 100% was performed in Virginia. See more on the Contracts tab