Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
General Lasertronics CorporationReport or remove this logo

General Lasertronics Corporation Federal Contracts

Correct this listing

Doing business as LASERTRONICS

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary QHNNBZLEWEA8· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 09HR7· FREMONT, CA· Active registration until Feb 27, 2027· www.lasertronics.com (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyNavy$2.19MBureau of Reclamation$400KNAVSEA HQ (N00024)$1.96M · Navy officeMP-REGIONAL OFFICE (140R20)$400K · Bureau of Reclamation officePUGET SOUND NAVAL SHIPYARD IMF(N4523A)$121K · Navy office1 more offices$102KGeneral Lasertronics Corporation$2.59M
Awards toSubcontracts toCircle area = dollars

Insight NAVSEA HQ (N00024) is its largest buyer. See more on the Buyers tab

4 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2001–FY2026

$6.67M

Includes FY2026 so far: $7,500, still being reported

Subcontracts it received

$242K

from 1 prime

About

From the company's SBA profile

Lasertronics builds laser-based coating removers for aerospace, automotive, and nuclear inspection. Commercial high power lasers are integrated into systems with automated features for removal without substrate damage, fire, or environmental impacts.

Prime contract obligations by fiscal year, US$, FY2001–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY01FY03FY10FY13FY15FY17FY20FY22$2.08MFY26FY26 so far: $7,500

Insight Largest year: $2.08M in FY2025. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$2.59M since award = $2.52M in FY2021–FY2026 + $72K before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. California$2.49M · 96%
  2. Hawaii$102K · 3.9%
Circle area = dollarsOutlined: head office state (California)

Insight 96% was performed in California. See more on the Contracts tab