Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Global Energy Of The Carolinas LLC federal contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary JWNKLDCF3J44· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 8KT26· Charlotte, NC· Active registration until Nov 7, 2026

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyState$91.2KU.S. Customs and BorderProtection$61.4KNavy$35.8K1 more$21.5KACQUISITIONS - AQM MOMENTUM (19AQ…$91.2K · State officeBORDER ENFORCEMENT CONTRACTING…$61.4K · U.S. Customs and Border Prote…NAVSUP FLT LOG CTR NORFOLK (N00189)$35.8K · Navy office2 more offices$21.5KGlobal Energy Of The Carolinas LLC$210K
Awards toGlobal Energy Of The Carolinas LLCConnectedGroupedCircle area = dollars

Insight ACQUISITIONS - AQM MOMENTUM (19AQMM) is its largest buyer. See more on the Buyers tab

5 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2024–FY2026

$210K

Includes FY2026 so far: −$448K, still being reported

About

From the company's SBA profile, updated Nov 2025

Global Energy was initially established as a company specializing in the construction and energy sectors. However, . The challenges posed by the COVID-19 pandemic prompted us to adapt, leading to diversification into various industries beyond construction. Our expanded capabilities now include successful ventures in supplying medical supplies and equipment to VA Hospitals. This includes providing essential Personal Protective Equipment (PPE) such as gowns, masks, and gloves, along with COVID-19 rapid antigen test kits. Additionally, we offer comprehensive lab and testing services.

Prime contract obligations by fiscal year, US$, FY2024–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY24FY25$570KFY26−$448K so far

Insight Largest year: $570K in FY2025. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Virginia$91.2K · 43%
  2. Puerto Rico$61.4K · 29%
  3. Connecticut$35.8K · 17%
  4. North Carolina$21.5K · 10%
Circle area = dollarsOutlined: head office state (North Carolina)

Insight 43% was performed in Virginia. See more on the Contracts tab