Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Govaged Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary RLP9ZUBG1A81· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 98WQ2· ALEXANDRIA, VA· Active registration until Jan 8, 2027· www.govaged.com (opens in a new tab)

Overview

Buyers and offices that award Govaged prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyArmy$3.28MAir Force$1.71MDefense Logistics Agency$1.49M17 more$2.77MW6QM MICC-FT DRUM (W911S2)$2.23M · Army officeDLA MARITIME - PUGET SOUND(SPMYM2)$1.43M · Defense Logistics Agency officeFA4861 99 CONS LGC$513K · Air Force office82 more offices$5.08MGovaged Inc.$9.25M
Awards toSubcontracts toCircle area = dollars

Insight W6QM MICC-FT DRUM (W911S2) is its largest buyer. See more on the Buyers tab

85 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2022–FY2026

$9.25M

Includes FY2026 so far: −$118K, still being reported

About

From the company's SBA profile, updated Jan 2026

Welcome to Govaged Inc, where we're reshaping the landscape of estimate services with cutting-edge technology and unparalleled expertise. At Govaged, we pride ourselves on offering innovative solutions that streamline the estimate process for individuals and businesses alike. Here's a narrative outlining our capabilities: Advanced Estimation Algorithms Multi-Domain Expertise User-Friendly Platform Customizable Solutions Transparent Pricing Responsive Customer Support Scalable Infrastructure Data Security and Confidentiality In conclusion, Govaged Inc is more than just an online estimate company – we're your trusted partner in precision estimation solutions. With our advanced technology, industry expertise, and commitment to excellence, we're revolutionizing the way estimates are conducted online, one project at a time. Experience the Govaged difference today and discover a new standard of accuracy, efficiency, and reliability in online estimates.

Prime contract obligations by fiscal year, US$, FY2022–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY22$4.35MFY23FY24FY25FY26−$118K so far

Insight Largest year: $4.35M in FY2022. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Virginia$4.56M · 49%
  2. California$1.44M · 16%
  3. Utah$443K · 4.8%
  4. Nevada$390K · 4.2%
  5. Ohio$235K · 2.5%

23 smaller, $2.12M together.

No US state recorded: $61K · 0.7%

Circle area = dollarsOutlined: head office state (Virginia)

Insight 50% was performed in Virginia. See more on the Contracts tab