Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Grace Environmental Services, Inc.Report or remove this logo

Grace Environmental Services, Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary WYRBGYTWLZB3· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 8R1C8· THOUSAND OAKS, CA· Active registration until Aug 21, 2027· www.graceenviro.com (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyDefense Health Agency$88.3KNational Park Service$39KDEFENSE HEALTH AGENCY HCD WEST(HT9410)$88.3K · Defense Health Agency officePWR GOGA(86000) (140P86)$39K · National Park Service officeGrace Environmental Services, Inc.$127K
Awards toSubcontracts toCircle area = dollars

Insight DEFENSE HEALTH AGENCY HCD WEST (HT9410) is its largest buyer. See more on the Buyers tab

2 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2023–FY2026

$127K

Includes FY2026 so far: $12.8K, still being reported

About

From the company's SBA profile, updated Aug 2026

GES operates and maintain water and wastewater treatment facilities. GES has a proven record of starting up new facilities; bring existing facilities into compliance, improving sustainability, and reducing overall operations and maintenance cost. GES team has extensive experience with direct design and construction oversight and experience in the operations and management of reverse osmosis systems. GES has operated conventional water treatment, and ground water remediation facilities. Our distribution system experience includes meter reading, line repair, leak detection and a full range of services expected when maintaining a distribution system. Our wastewater operation experience ranges from a 140,000 GPD sequence batch reactor plant to a 16 MGD activated sludge facility. GES is a professionally licensed wastewater operator who can address customers’ unique needs and provide solutions.

Prime contract obligations by fiscal year, US$, FY2023–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY23FY24$42.5KFY25FY26$12.8K so far

Insight Largest year: $42.5K in FY2024. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. California$127K · 100%
Circle area = dollarsOutlined: head office state (California)

Insight 100% was performed in California. See more on the Contracts tab