Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Gradient Marine Federal Contracts

Correct this listing

Doing business as OCEAN GUYS ENGINEERING PC

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary C349NM5Z51E8· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 858W3· SAN DIEGO, CA· Active registration until Feb 26, 2027· gradientmarine.com (opens in a new tab)

Overview

Buyers and offices that award Gradient Marine prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyNavy$140KNAVAIR WARFARE CTR AIRCRAFT DIV(N68335)$140K · Navy officeNSWC DAHLGREN (N00178)$500 · Navy officeGradient Marine$140K
Awards toSubcontracts toCircle area = dollars

Insight NAVAIR WARFARE CTR AIRCRAFT DIV (N68335) is its largest buyer. See more on the Buyers tab

2 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2023–FY2026

$140K

Subcontracts it received

$3.08M

from 4 primes

About

From the company's SBA profile, updated Mar 2026

Gradient Marine specializes in maritime surveillance & undersea warfare. We support CONUS and OCONUS USG projects in maritime security mission areas (i.e. Maritime Domain Awareness (MDA), Anti-Submarine Warfare (ASW), etc.). Services fall into several categories: 1) engineering & technical solutions; 2) strategic planning; 3) operations support; 4) acquisition expertise; and 5) program management. Typical support may include capability gap analysis, requirements & CONOPS development, technical & programmatic Subject Matter Expert (SME) services, engineering design & analysis, test planning & support, project coordination & portfolio management, and technical & financial risk analysis. We have expertise in manned & unmanned maritime systems; command, control, communications, computers, & intelligence (C4I) technology; conventional & unconventional acquisitions; Foreign Military Sales (FMS) projects; and Building Partner Capacity (BPC) programs.

Prime contract obligations by fiscal year, US$, FY2023–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY23$140KFY25$500

Insight Largest year: $140K in FY2023. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. California$140K · 100%
Circle area = dollarsOutlined: head office state (California)

Insight 100% was performed in California. See more on the Contracts tab