Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

GSL Biotech, LLC Federal Contracts

Correct this listing

Doing business as GSL BIOTECH LLC

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary M78LBLFHT5S4· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 48VC1· BOSTON, MA· Registration not active until Jan 14, 2026· www.snapgene.com (opens in a new tab)

Part of Graphpad Software, LLC (opens another page) (parent company) · One of 6 registrations

Overview

Buyers and offices that award GSL Biotech prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyNational Institutes ofHealth$120KNATIONAL INSTITUTES OF HEALTH NHLBI(75N920)$51.4K · National Institutes of Health of…NATIONAL INSTITUTES OF HEALTH NICHD(75N940)$30.2K · National Institutes of Health of…NIH NCI (75N910)$27.6K · National Institutes of Health of…1 more offices$10.5KGSL Biotech, LLC$120K
Awards toSubcontracts toCircle area = dollars

Insight NATIONAL INSTITUTES OF HEALTH NHLBI (75N920) is its largest buyer. See more on the Buyers tab

4 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2019–FY2026

$143K

About

From the company's SBA profile, updated Jan 2025

SnapGene provides the easiest and most secure way to plan, visualize, and document your everyday molecular biology procedures. SnapGene makes your DNA manipulations easy to visualize and simulate and alerts you to errors before they happen. SnapGene’s. DNA files can be opened by the free cross-platform SnapGene Viewer, enabling you to share richly annotated maps and sequences with colleagues. SnapGene automatically generates a record of every sequence edit and cloning procedure, so you will not lose track of how a construct was made, even after a lab member leaves.

Prime contract obligations by fiscal year, US$, FY2019–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY19FY20FY22FY23$41.7KFY24FY25$16.2K

Insight Largest year: $41.7K in FY2023. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Massachusetts$56.4K · 47%
  2. California$51.9K · 43%
  3. Maryland$11.4K · 9.5%
Circle area = dollarsOutlined: head office state (Massachusetts)

Insight 47% was performed in Massachusetts. See more on the Contracts tab