Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started
Hyertek Inc.Report or remove this logo

Hyertek Inc. Federal Contracts

Correct this listing

Doing business as HYERTEK INC

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary VB6GZHHDA7G3· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 7ZP05· ROCKVILLE, MD· Active registration until Aug 3, 2027· www.hyertek.com (opens in a new tab)

Overview

Buyers and offices that award Hyertek prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyNavy$902KNational Park Service$175KBureau of the FiscalService$83.5K2 more$77.4KNAVSUP FLT LOG CTR NORFOLK (N00189)$902K · Navy officeWASHINGTON CONTRACTING OFFICE(140P21)$175K · National Park Service officeARC DIV PROC SVCS - CSB (203562)$83.5K · Bureau of the Fiscal Service of…4 more offices$77.9KHyertek Inc.$1.24M
Awards toSubcontracts toCircle area = dollars

Insight NAVSUP FLT LOG CTR NORFOLK (N00189) is its largest buyer. See more on the Buyers tab

7 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2018–FY2026

$1.25M

Includes FY2026 so far: $500, still being reported

About

From the company's SBA profile, updated Aug 2026

Founded in 2016, HyerTek Inc. is a privately-owned SBA Small Disadvantaged Business, Authorized Montgomery County, MD Local Small Business Reserve Program Entity, and State of Maryland Small Business Enterprise (SBE) headquartered in Rockville, Maryland. HyerTek has a proven track record of providing best-in-class solutions to public sector, healthcare, education, and commercial entities. We help organizations modernize and transform their business and technical operations by first focusing on people and process-oriented needs. HyerTek provides technology and training-based services to organizations as small as two to as large as several hundred thousand personnel. Our domain expertise includes Cloud Computing, Data Analytics, Business Intelligence, Cyber Security, Enterprise System Modernization (ERP, CRM, HCM), knowledge-based platforms such as portals and collaboration tools, human-centered design/UX, and IT training platforms.

Prime contract obligations by fiscal year, US$, FY2018–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY18FY19FY20FY21FY22FY23$504KFY24FY25FY26$500 so far

Insight Largest year: $504K in FY2023. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$1.24M since award = $1.18M in FY2021–FY2026 + $53.8K before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. District of Columbia$632K · 51%
  2. Maryland$369K · 30%
  3. Rhode Island$167K · 13%
  4. Georgia$69.6K · 5.6%
  5. Alabama$500 · 0.0%
Circle area = dollarsOutlined: head office state (Maryland)

Insight 51% was performed in District of Columbia. See more on the Contracts tab