Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Immedica Pharma US Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary MS6UM2NBDW91· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 4BX80· CHICAGO, IL· Active registration until Mar 13, 2027· www.marinuspharma.com (opens in a new tab)

Overview

Buyers and offices that award its prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyOffice of AssistantSecretary forPreparedness and Respon…$33.7MBARDA - ASPR / DAAPPO / BARDA DCMA(75A501)$33.7M · Office of Assistant Secretary…Immedica Pharma US Inc.$33.7M
Awards toSubcontracts toCircle area = dollars

Insight BARDA - ASPR / DAAPPO / BARDA DCMADCMA: the Defense agency that manages contracts after award: payments, quality checks, property and contractor business systems. Glossary (75A501) is its largest buyer. See more on the Buyers tab

1 buying office

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2020–FY2026

$33.7M

About

From the company's SBA profile, updated Mar 2026

Marinus is dedicated to improving treatment outcomes for patients with rare epilepsies and seizure disorders. Our lead drug candidate is designed to exhibit anti-epileptic activity by virtue of its GABAA receptor modulating properties and is being developed in intravenous (IV) and oral formulations intended to maximize therapeutic reach to adult and pediatric patient populations in both acute and chronic care settings.

Prime contract obligations by fiscal year, US$, FY2020–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY20$21.3MFY22FY23FY24$0

Insight Largest year: $21.3M in FY2020; since FY2021, $12.3M in FY2022. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$33.7M since award = $12.3M in FY2021–FY2026 + $21.3M before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Pennsylvania$33.7M · 100%
Circle area = dollarsOutlined: head office state (Illinois)

Insight 100% was performed in Pennsylvania. See more on the Contracts tab