Arrow keys move between marks; Enter selects; F opens full screen.

Skip to content
Procura
Get started

Impact Resources, Inc. Federal Contracts

Correct this listing

UEIUEI: the 12-character ID the government gives every company registered for federal work. It replaced the DUNS number in April 2022. Glossary RDCTL3NVCZD6· CAGECAGE code: a 5-character code that identifies one company location for federal work. A company with several sites can have several. Glossary 1S3J7· RESTON, VA· Active registration until Jan 31, 2027· www.entelliteq.com (opens in a new tab)

Overview

Buyers and offices that award Impact Resources prime contracts, US$, active FY2021–FY2026

Obligated since award on contracts active FY2021–FY2026

Click a company to open its profile.

Buyers (sub-agency)OfficesThis companyNavy$500NSWC DAHLGREN (N00178)$500 · Navy office1 more offices$0Impact Resources, Inc.$500
Awards toSubcontracts toCircle area = dollars

Insight NSWC DAHLGREN (N00178) is its largest buyer. See more on the Buyers tab

2 buying offices

Prime contract obligationsObligation: money the government has legally committed to a contract. It is not the same as money paid. Example: $6M obligated of a $10M ceiling. Glossary, FY2002–FY2026

$79.8M

Subcontracts it received

$899K

from 2 primes

About

From the company's SBA profile

IR Technologies (IR Tech) is a small business focused on enterprise information technology (IT) opportunities since 2001. Our commitment is to provide domain experts and thought leaders to deliver high quality IT life cycle services. While the company has concentrated on Marine Corps Logistics Systems and IT Programs delivering verifiable cost savings to the Marine Corps of over $100 million to date, IR Tech has also supported other high visibility information programs such as the Navy’s Next Generation Network and Marine Corps unclassified network (NGEN), and the Marine Corps Secret enterprise wide network (SIPRNET) among others. IR Tech provides software development services and training along with data management and cleansing techniques and tools for modernizing legacy systems. We also enable executable methodologies for deploying and sustaining business systems in austere and constrained environments. IR Tech is appraised at CMMI Level III for both Services and Development.

Prime contract obligations by fiscal year, US$, FY2002–FY2026

Agencies report with a delay; the latest year will rise

Hover over a year to see its value.

FY02FY04FY06FY08FY11$12MFY13FY15FY17FY19FY24$0

Insight Largest year: $12M in FY2012; since FY2021, $0 in FY2024. See more on the Contracts tab

Prime obligations since award by state of performance, US$, contracts active FY2021–FY2026

$500 since award = −$2,501 in FY2021–FY2026 + $3,001 before FY2021

Click a state to open its page.

AKMEVTNHWAIDMTNDMNILWIMINYRIMAORNVWYSDIAINOHPANJCTCAUTCONEMOKYWVVAMDDEAZNMKSARTNNCSCDCOKLAMSALGAHITXFLPR
  1. Virginia$500 · 100%
Circle area = dollarsOutlined: head office state (Virginia)

Insight 100% was performed in Virginia. See more on the Contracts tab